Synthetic peptide directed towards the N terminal region of human ACTR2
Application
Anti-ACTR2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.
Biochem/physiol Actions
ACTR2 gene encodes a protein called actin-related protein 2, which is an ATP-binding component of the Arp2/3 complex. The complex stimulates actin polymerization in lamellipodia as well as facilitates its protrusion.
Sequence
Synthetic peptide located within the following region: NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The Journal of cell biology, 138(2), 375-384 (1997-07-28)
The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells. The human complex consists of seven subunits which include the actin related proteins Arp2 and Arp3, and five others referred to as p41-Arc, p34-Arc, p21-Arc
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.