WH0023404M6

Monoclonal Anti-EXOSC2 antibody produced in mouse

clone 4B6, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-RRP4, Anti-Rrp4p, Anti-exosome component 2, Anti-hRrp4p, Anti-p7
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 4B6, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): indirect ELISA: suitable
• Isotyp: IgG2aκ
• GenBank-Hinterlegungsnummer: NM_014285
• UniProt-Hinterlegungsnummer: Q13868
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... EXOSC2(23404)

Beschreibung

Allgemeine Beschreibung

EXOSC2 (Exosome component 2) is a non-catalytic subunit of the eukaryotic RNA exosome. It is localized in the nucleus and in the cytoplasm.

Immunogen

EXOSC2 (NP_055100, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRS

Biochem./physiol. Wirkung

EXOSC2 (Exosome component 2) is associated with several cellular processes such as rRNA processing, RNA degradation from the 3′ end, 3′ to 5′ decay of the mRNA body after its deadenylation. Exosome complex is an ~400kDa multimeric complex, which plays a vital role in substrate recognition. EXOSC2 functions as a cofactor in the maintenance of human exosome integrity and efficient degradation and/or metabolism of various RNA classes.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)