SAB5702186

Anti-ACVR1 Antibody, clone 1J7G4, Rabbit Monoclonal

• Synonym(e): ACVR1, ACTRI, ACVR1A, ACVRLK2, ALK2, FOP, SKR1, TSRI, activin receptor type-1
• UNSPSC-Code: 12352203
• NACRES: NA.46

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Materialien: colorless
• Klon: 1J7G4, monoclonal
• Form: liquid
• Mol-Gew.: 57 kDa
• Speziesreaktivität: human, rat, rat
• Konzentration: 1.2 mg/mL
• Methode(n): western blot: 1:500 - 1:1000
• Farbe: colorless
• Isotyp: IgG
• Immunogene Sequenz: VLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
• UniProt-Hinterlegungsnummer: Q04771
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ACVR1(90)

Beschreibung

Allgemeine Beschreibung

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive.

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 410-509 of human ACVR1 (Q04771).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Anwendung

WB

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1