SAB5200928

Monoclonal Anti-Sur2A - Atto 594 antibody produced in mouse

clone S319A-14, purified immunoglobulin

• Synonym(e): Anti-ABC37, Anti-ABCC9, Anti-CMD10, Anti-Sulfonylurea receptor 2A
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Qualitätsniveau: 100
• Konjugat: Atto 594 conjugate
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: S319A-14, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen predicted mol wt 120 kDa
• Speziesreaktivität: rat, mouse
• Konzentration: 1 mg/mL
• Methode(n): immunocytochemistry: suitable; immunohistochemistry: suitable; western blot: suitable
• Isotyp: IgG2a
• NCBI-Hinterlegungsnummer: NP_001038185.1
• UniProt-Hinterlegungsnummer: P70170
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: mouse ... Abcc9(20928)

Beschreibung

Immunogen

Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A

Leistungsmerkmale und Vorteile

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physikalische Form

PBS pH7.4, 50% glycerol, 0.09% sodium azide

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable