SAB2108787

Anti-THRA antibody produced in rabbit biotin conjugated

affinity isolated antibody

• Synonym(e): ENV, ENVW, ERVWE1, HERV-7q, HERV-W-ENV
• UNSPSC-Code: 12352203
• NACRES: NA.43

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: biotin conjugate
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 55 kDa
• Speziesreaktivität (Voraussage durch Homologie): human, zebrafish, mouse, bovine, rabbit, rat, horse, guinea pig, canine
• Konzentration: 0.5 mg/mL
• NCBI-Hinterlegungsnummer: NM_003250
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... THRA(7067)

Beschreibung

Allgemeine Beschreibung

The THRA gene encodes a protein that is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone.

Immunogen

Synthetic peptide directed towards the middle region of human THRA

Sequenz

Synthetic peptide located within the following region: DQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVV

Physikalische Form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: nwg
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable