SAB2108707

Anti-RHBDF1

affinity isolated antibody

• Synonym(e): Anti- Dist1, Anti- EGFR-RS, Anti- FLJ2235, Anti- FLJ22357, Anti-C16orf8
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 97 kDa
• Speziesreaktivität: mouse, guinea pig, horse, rat, rabbit, dog, bovine, human
• Konzentration: 0.5-1 mg/mL
• Methode(n): immunoblotting: suitable
• Hinterlegungsnummer: NM_022450
• UniProt-Hinterlegungsnummer: Q96CC6
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... RHBDF1(64285)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human RHBDF1

Biochem./physiol. Wirkung

RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.

Sequenz

Synthetic peptide located within the following region: KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable