SAB2108678

Anti-HSD3B2

affinity isolated antibody

• Synonym(e): Anti- HSD3B, Anti- HSDB3, Anti- SDR11E2, Anti-HSDB
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 42 kDa
• Speziesreaktivität: human
• Konzentration: 0.5-1 mg/mL
• Methode(n): immunoblotting: suitable; immunohistochemistry: suitable
• Hinterlegungsnummer: NM_000198
• UniProt-Hinterlegungsnummer: P26439
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... HSD3B2(3284)

Beschreibung

Immunogen

Synthetic peptide directed towards the N terminal region of human HSD3B2

Biochem./physiol. Wirkung

3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.

Sequenz

Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable