SAB2108565

Anti-SLC1A5

IgG fraction of antiserum

• Synonym(e): Anti- ASCT2, Anti- ATBO, Anti- FLJ31068, Anti- M7V1, Anti-AAAT
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 60 kDa
• Speziesreaktivität: rat, bovine, sheep, horse, human, pig, dog, mouse
• Konzentration: 0.5-1 mg/mL
• Methode(n): immunoblotting: suitable; immunohistochemistry: suitable
• Hinterlegungsnummer: NM_005628
• UniProt-Hinterlegungsnummer: Q71UA6
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SLC1A5(6510)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human SLC1A5

Biochem./physiol. Wirkung

SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated amino acids, anionic amino acids, and cationic amino acids. It acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses.

Sequenz

Synthetic peptide located within the following region: FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable