SAB1402579

Monoclonal Anti-DBR1 antibody produced in mouse

clone 3A7, purified immunoglobulin, buffered aqueous solution

• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 3A7, monoclonal
• Form: buffered aqueous solution
• Mol-Gew.: antigen ~36.45 kDa
• Speziesreaktivität: human
• Methode(n): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• NCBI-Hinterlegungsnummer: NM_016216
• UniProt-Hinterlegungsnummer: Q9UK59
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... DBR1(51163)

Beschreibung

Allgemeine Beschreibung

The RNA lariat debranching enzyme, or DBR1, specifically hydrolyzes 2-prime-to-5-prime branched phosphodiester bonds at the branch point of excised lariat intron RNA and converts them into linear molecules.[supplied by OMIM

Immunogen

DBR1 (NP_057300.2, 445 a.a. ~ 538 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDD

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable