SAB1400646

Anti-SH3GLB2 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

• Synonym(e): Anti-KIAA1848
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): immunofluorescence: suitable; western blot: 1 μg/mL
• UniProt-Hinterlegungsnummer: Q9NR46
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SH3GLB2(56904)

Beschreibung

Allgemeine Beschreibung

The gene SH3GLB2 (SH3 domain-containing GRB2-like protein B2) is mapped to human chromosome 9q34. The encoded protein belongs to the endophilin family of BAR and Src homology 3 domain-containing proteins. SH3GLB2 localizes in the meshwork of perinuclear filamentous structures. The protein contains an N-BAR (bin, amphiphysin and rvs) domain and a SH3 (src homology 3) domain.

Immunogen

SH3GLB2 (NP_064530.1, 1 a.a. ~ 395 a.a) full-length human protein.

Sequence
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAVATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS

Biochem./physiol. Wirkung

SH3GLB2 (SH3 domain-containing GRB2-like protein B2) associates with SH3GLB1. It also interacts with plectin-1 and vimentin. SH3GLB2 is involved in reorganization of vimentin around nuclei and nuclear positioning.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable