Direkt zum Inhalt
Merck

HPA037504

Sigma-Aldrich

Anti-UIMC1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-RAP80, Anti-Ubiquitin interaction motif containing 1

Anmeldenzur Ansicht organisationsspezifischer und vertraglich vereinbarter Preise


About This Item

UNSPSC-Code:
12352203
Human Protein Atlas-Nummer:
NACRES:
NA.41

Biologische Quelle

rabbit

Qualitätsniveau

Konjugat

unconjugated

Antikörperform

affinity isolated antibody

Antikörper-Produkttyp

primary antibodies

Klon

polyclonal

Produktlinie

Prestige Antibodies® Powered by Atlas Antibodies

Form

buffered aqueous glycerol solution

Speziesreaktivität

human

Erweiterte Validierung

independent
recombinant expression
Learn more about Antibody Enhanced Validation

Methode(n)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Immunogene Sequenz

LLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSG

UniProt-Hinterlegungsnummer

Versandbedingung

wet ice

Lagertemp.

−20°C

Posttranslationale Modifikation Target

unmodified

Angaben zum Gen

human ... UIMC1(51720)

Allgemeine Beschreibung

Ubiquitin interaction motif containing 1 (UIMC1), also called receptor-associated protein 8 (RAP80), is a transcriptional activator protein. It encodes a 79.6 kDa protein and is localised in nucleus. It is highly expressed in testis. UIMC1 contains a nuclear localization signal and two zinc fingers at the C-terminus. It has tandem ubiquitin interacting motifs (UIMs). The UIMC1 gene is located on human chromosome 5q35.2.

Immunogen

ubiquitin interaction motif containing 1 recombinant protein epitope signature tag (PrEST)

Anwendung

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem./physiol. Wirkung

Ubiquitin interaction motif containing 1 (UIMC1) functions as repressor for the nuclear receptor, retinoid-related, testis-associated receptor (RTR). It coordinates the placement of breast cancer type 1 susceptibility protein (BRCA1) in the site of DNA damage. Mutations in UIMC1 leads to impairment of BRCA1 mediated DNA repair and is implicated in breast cancer.

Leistungsmerkmale und Vorteile

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST79996

Physikalische Form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sie haben nicht das passende Produkt gefunden?  

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklassenschlüssel

10 - Combustible liquids

WGK

WGK 1

Flammpunkt (°F)

Not applicable

Flammpunkt (°C)

Not applicable


Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Familial breast cancer screening reveals an alteration in the RAP80 UIM domain that impairs DNA damage response function
Nikkila J, et al.
Oncogene, 28(16), 90-95 (2017)
Molecular Defects In BRCC3 Complex, a Novel Pathogenic Pathway In MDS
Makishima H, et al.
Blood, 122(21), 264-264 (2013)
The ubiquitin-interacting motif-containing protein RAP80 interacts with BRCA1 and functions in DNA damage repair response
Yan J, et al.
Cancer Research, 67(14), 6647-6656 (2007)
Linkage-specific avidity defines the lysine 63-linked polyubiquitin-binding preference of rap80
Sims JJ and Cohen RE
Molecular Cell, 33(6), 775-783 (2009)
RAP80, a novel nuclear protein that interacts with the retinoid-related testis-associated receptor
Yan Z, et al.
The Journal of Biological Chemistry, 277(35), 32379-32388 (2002)

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung.