HPA021046

Anti-UBR4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-600 kDa retinoblastoma protein-associated factor, Anti-E3 ubiquitin-protein ligase UBR4, Anti-N-recognin-4, Anti-RBAF600, Anti-Retinoblastoma-associated factor of 600 kDa, Anti-Zinc finger UBR1-type protein 1, Anti-p600
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA021046
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry: 1:50- 1:200
• Immunogene Sequenz: VEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEISNNNSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLNLSRSRWFDFPFTREEALQADKKLNLFIGASVDPAGVTMIDAVKIYGKTKEQF
• UniProt-Hinterlegungsnummer: Q5T4S7
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... UBR4(23352)

Beschreibung

Allgemeine Beschreibung

The gene UBR4 (ubiquitin protein ligase E3 component n-recognin 4) is mapped to human chromosome 1p36.13. The protein localizes in the cytoplasm and the nucleus. UBR4 is also referred to as p600.

Immunogen

E3 ubiquitin-protein ligase UBR4 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-UBR4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem./physiol. Wirkung

UBR4 (ubiquitin protein ligase E3 component n-recognin 4) interacts with retinoblastoma protein in the nucleus and functions as a chromatin scaffold. In the cytoplasm, UBR4 regulates cytoskeletal dynamics and membrane morphogenesis. It is important for formation of integrin-mediated ruffled membrane and cell survival. UBR4 forms an E2-E3 complex with RAD6 (ubiquitin-conjugating enzyme E2) and KCMF1 (potassium channel modulatory factor 1). The complex regulates lysosome-mediated degradation of N-end rule substrates. UBR4 associates with human papillomavirus type 16 (HPV-16) E7 oncoprotein and participates in anchorage-independent growth in cancer cells.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST72607

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable