HPA014785

Anti-TRPM1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(e): Anti-CSNB1C, Anti-LTRPC1, Anti-MLSN1
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA014785

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry: 1:50- 1:200
• Immunogene Sequenz: VGGVNQDVEYSSITDQQLTTEWQCQVQKITRSHSTDIPYIVSEAAVQAEHKEQFADMQDEHHVAEAIPRIPRLSLTITDRNGMENLLSVKPDQTLGFPSLRSKSLHGHPRNVKSIQGKL
• UniProt-Hinterlegungsnummer: Q7Z4N2
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... TRPM1(4308)

Beschreibung

Allgemeine Beschreibung

TRPM1 (transient receptor potential cation channel, subfamily M, member 1) belongs to the subfamily of ion channels called TRPM. It was the first member of this family to be identified, and it was recognized as a melanoma metastasis suppressor. It is expressed by melanocytes of skin and eye. This ion channel is also coupled with mGluR6 (metabotropic glutamate receptor 6), and co-localizes with it at the dendrites of ON-bipolar cells. This gene is localized to human chromosome 15q13.3.

Immunogen

Transient receptor potential cation channel subfamily M member 1 recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-TRPM1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

Biochem./physiol. Wirkung

TRPM1 (transient receptor potential cation channel, subfamily M, member 1) is responsible for the control of Ca²⁺ homeostasis during melanogenesis, which is also influenced by ultraviolet B. Its expression and the intracellular Ca²⁺ levels are significantly lower in rapidly dividing melanocytes, as opposed to differentiated melanocytes. It is also under-expressed in melanomas with metastatic potential. TRPM1 mRNA expression can be helpful in differentiating Spitz nevi and nodular melanomas. It is essential for synaptic communication between photoreceptors and ON-bipolar cells. In patients with Melanoma-associated retinopathy (MAR), the auto-antibodies are shown to bind with TRPM1 in bipolar cells, and might be responsible for non-responsiveness of cells to light. This gene is also linked with autosomal recessive congenital stationary night blindness.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST73285.

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)