AV45366

Anti-PTPRA antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-HEPTP, Anti-HLPR, Anti-HPTPA, Anti-HPTPalpha, Anti-LRP, Anti-PTPA, Anti-PTPRL2, Anti-Protein tyrosine phosphatase, receptor type, A
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 2

Eigenschaften

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 89 kDa
• species reactivity: rabbit, rat, human, bovine, guinea pig, dog, horse, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_543030
• UniProt accession no.: P18433
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PTPRA(5786)

Beschreibung

Immunogen

Synthetic peptide directed towards the C terminal region of human PTPRA

Application

Anti-PTPRA (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Protein tyrosine phosphatase, receptor type A (PTPRA; R-PTPalpha) is a member of protein tyrosine phosphatase (PTP) family involved in cell growth, differentiation and mitosis. PTPRA dephosphorylates Src kinases and regulates integrin signaling involved in cell adhesion and proliferation.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: SRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAG

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable