Anmelden zur Ansicht der Organisations- und Vertragspreise.
Größe auswählen
Über diesen Artikel
UNSPSC Code:
12352202
Technischer Dienst
Benötigen Sie Hilfe? Unser Team von erfahrenen Wissenschaftlern ist für Sie da.
Unterstützung erhaltenTechnischer Dienst
Benötigen Sie Hilfe? Unser Team von erfahrenen Wissenschaftlern ist für Sie da.
Unterstützung erhaltenrecombinant
expressed in E. coli
assay
>80% (SDS-PAGE)
form
buffered aqueous solution
mol wt
predicted mol wt 28 kDa
purified by
immobilized metal affinity chromatography (IMAC)
concentration
≥0.5 mg/mL
immunogen sequence
VMDNLKSQSPLPEQSPCLLPGFRVLNDFLAHHVHIPEVYLIVSTFFLQTPLTELMDGPKDSLDAMLQWLLQRHHQEEVLQAGLCTEGALLLLEM
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... WDFY4(57705)
General description
Recombinant protein fragment of Human WDFY4 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.
Application
Suitable as a blocking agent using corresponding antibodies.
Physical form
Solution in 1 M urea-PBS, pH 7.4
Preparation Note
The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
Other Notes
Corresponding Antibody HPA040634.
Legal Information
Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Lagerklasse
10 - Combustible liquids
wgk
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Hier finden Sie alle aktuellen Versionen:
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
Global Trade Item Number
| SKU | GTIN |
|---|---|
| APREST80243-100UL | 04061835816217 |
Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..
Setzen Sie sich mit dem technischen Dienst in Verbindung