Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

HPA008788

Sigma-Aldrich

Anti-TP53BP1 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-53BP1 antibody produced in rabbit, Anti-Tumor suppressor p53-binding protein 1 antibody produced in rabbit, Anti-p53-binding protein 1 antibody produced in rabbit, Anti-p53BP1 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
western blot: 0.04-0.4 μg/mL

immunogen sequence

AYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEAL

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TP53BP1(7158)

General description

TP53BP1 (tumor protein p53 binding protein 1) was initially recognized as a p53-binding protein, which increases the transcriptional activity of p53. It is also a tumor suppressor protein. This protein contains two BRCA1 domains in its C-terminal, called BRCA1 C-terminal (BRCT) domains. This protein is localized to the nucleus.

Immunogen

Tumor suppressor p53-binding protein 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

TP53BP1 (tumor protein p53 binding protein 1) plays an essential role in DNA damage repair and cell cycle control, where it interacts with damage sensors and signal transducers. It is involved in DSB (double strand break) repairs, and mediates microhomology-mediated end-joining (MMEJ) in G1-phase cells. In breast cancer, this protein acts as a tumor suppressor, and as a marker for the prognosis of breast cancer. It also inhibits angiogenesis in the same. Three variants of this gene are linked with reduced risk of basal cell carcinoma (BCC).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70850

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Lei Liu et al.
PloS one, 9(3), e90931-e90931 (2014-03-08)
The TP53BP1 gene may be involved in the development of cancer through disrupting DNA repair. However, studies investigating the relationship between TP53BP1 Glu353Asp (rs560191) polymorphism and cancer yielded contradictory and inconclusive outcomes. In order to realize these ambiguous findings, a
Xiaoyan Li et al.
Cancer science, 104(11), 1420-1426 (2013-08-06)
In our previous study, we found that 53BP1 was a tumor suppressor and was associated with prognosis in breast cancer. However, little is known about its role in angiogenesis. In the present study, we aimed to reveal the role of
Genetic variants in the 53BP1 gene and skin cancer risk.
Chunyan He et al.
The Journal of investigative dermatology, 130(12), 2850-2853 (2010-08-06)
Xiahui Xiong et al.
Nucleic acids research, 43(3), 1659-1670 (2015-01-15)
Alternative non-homologous end joining (alt-NHEJ) was originally identified as a backup repair mechanism in the absence of classical NHEJ (c-NHEJ) factors but recent studies have demonstrated that alt-NHEJ is active even when c-NHEJ as well as homologous recombination is available.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service