Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

SAB2102610

Sigma-Aldrich

Anti-TUT1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-FLJ21850, Anti-FLJ22267, Anti-FLJ22347, Anti-MGC131987, Anti-Terminal uridylyl transferase 1, U6 snRNA-specific

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

94 kDa

reactividad de especies

guinea pig, bovine, human, horse, dog

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... TUT1(64852)

Descripción general

The previously assigned protein identifier A8K995 has been merged into Q9H6E5. Full details can be found on the UniProt database.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human TUT1

Acciones bioquímicas o fisiológicas

TUT1 is a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A) polymerase. TUT1 specifically adds and removes nucleotides from the 3′ end of small nuclear RNAs and select mRNAs and may function in controlling gene expression and cell proliferation.TUT1 specifically catalyzes uridylylation of U6 snRNA (RNU6; MIM 180692) and is essential for cell proliferation (Trippe et al., 2006 [PubMed 16790842]).[supplied by OMIM].

Secuencia

Synthetic peptide located within the following region: CDLDLFLDLGDLEEPQPVPKAPESPSLDSALASPLDPQALACTPASPPDS

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Emily C Knouf et al.
PloS one, 8(7), e69630-e69630 (2013-07-23)
Post-transcriptional modifications of miRNAs with 3' non-templated nucleotide additions (NTA) are a common phenomenon, and for a handful of miRNAs the additions have been demonstrated to modulate miRNA stability. However, it is unknown for the vast majority of miRNAs whether

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico