Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

SAB1405964

Sigma-Aldrich

Anti-HRAS Antibody

mouse polyclonal

Sinónimos:

C-BAS/HAS, C-H-RAS, C-HA-RAS1, CTLO, H-RASIDX, HAMSV, HRAS1, K-RAS, N-RAS

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
En este momento no podemos mostrarle ni los precios ni la disponibilidad

Nombre del producto

Anti-HRAS antibody produced in mouse, purified immunoglobulin, buffered aqueous solution

origen biológico

mouse

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

antigen ~20.79 kDa

reactividad de especies

human

técnicas

proximity ligation assay: suitable
western blot: 1 μg/mL

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... HRAS(3265)

Descripción general

Harvey rat sarcoma viral oncogene homolog (HRAS) is a member of the Ras oncogene family. The HRAS gene is mapped to human chromosome 11p15.5 and is expressed in different isoforms. HRAS comprises a conserved G domain and a hypervariable region. The G domain, in turn, contains switch I and II domains. It also harbors the secondary signal domain and the CAAX motif. The HRAS protein is localized to the Golgi membrane.

Inmunógeno

HRAS (NP_005334, 1 a.a. ~ 189 a.a) full-length human protein.

Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS

Aplicación

Anti-HRAS antibody produced in mouse has been used in western blotting.[1]

Acciones bioquímicas o fisiológicas

Harvey rat sarcoma viral oncogene homolog (HRAS) exists as guanosine triphosphate (GTP)-bound form when associated with non-ordered lipid domains. However, with the lipid rafts of the plasma membrane, HRAS is present in a guanosine diphosphate (GDP)-bound state. It regulates the signaling events in a wide variety of cellular processes. Germline mutations in the HRAS gene results in Costello syndrome, a disease with cardiovascular abnormalities, growth deficiency, and musculoskeletal abnormalities. The HRAS gene defects are also implicated in the pathophysiology of many tumors including epithelial-myoepithelial carcinoma (EMC), thyroid, oral squamous cell carcinoma, and bladder cancer.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Christian P Kratz et al.
Human molecular genetics, 16(4), 374-379 (2006-12-14)
Costello syndrome (CS; MIM 218040) is characterized by short stature, facial dysmorphism, cardiac defects and predisposition to embryonal rhabdomyosarcoma (CS/ERMS) and other neoplasias. CS is caused by germline mutations in the HRAS gene on chromosome 11p15.5, a region showing allelic
Lihua Shu et al.
Molecular cancer therapeutics, 19(4), 999-1007 (2020-04-04)
H-Ras is a unique isoform of the Ras GTPase family, one of the most prominently mutated oncogene families across the cancer landscape. Relative to other isoforms, though, mutations of H-Ras account for the smallest proportion of mutant Ras cancers. Yet
Anne-Mette Hartung et al.
PLoS genetics, 12(5), e1006039-e1006039 (2016-05-20)
Costello syndrome (CS) may be caused by activating mutations in codon 12/13 of the HRAS proto-oncogene. HRAS p.Gly12Val mutations have the highest transforming activity, are very frequent in cancers, but very rare in CS, where they are reported to cause
Sònia Guil et al.
Cancer research, 63(17), 5178-5187 (2003-09-23)
We characterized a novel protein of the Ras family, p19 (H-RasIDX). The c-H-ras proto-oncogene undergoes alternative splicing of the exon termed IDX. We show that the alternative p19 mRNA is stable and as abundant as p21 (p21 H-Ras4A) mRNA in
Makoto Urano et al.
The American journal of surgical pathology, 43(7), 984-994 (2019-04-18)
Epithelial-myoepithelial carcinoma (EMC) is a rare salivary gland tumor that is histologically characterized by biphasic tubular structures composed of inner ductal and outer clear myoepithelial cells. Because of its histologic variety, it is sometimes challenging to make an accurate diagnosis

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico