Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

HPA051171

Sigma-Aldrich

Anti-FKBP10 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-FK506 binding protein 10, 65 kDa, Anti-FKBP6, Anti-FLJ20683, Anti-FLJ22041, Anti-FLJ23833, Anti-hFKBP65

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.43

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

secuencia del inmunógeno

CSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSRED

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... FKBP10(60681)

Descripción general

FK506 binding protein 10 (FKBP10) is expressed in the endoplasmic reticulum. It is a peptidyl-prolyl cis-trans isomerase, with a molecular weight of 65kDa. The gene encoding this protein is localized on human chromosome 17q21.2.

Inmunógeno

FK506 binding protein 10, 65 kDa recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-FKBP10 antibody produced in rabbit has been used in immunohistochemistry.

Acciones bioquímicas o fisiológicas

FK506 binding protein 10 (FKBP10) is a chaperone protein. It is thought to be a chaperone of type I collagen. Mutations in the FKBP10 gene have been linked to Bruck syndrome, which is characterized by bone fragility and congenital joint contractures.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST85546

Forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Kuskokwim syndrome, a recessive congenital contracture disorder, extends the phenotype of FKBP10 mutations
Aileen M. Barnes
Human Mutation, 34(9), 1279?1288-1279?1288 (2013)
Osama H Essawi et al.
European journal of medical genetics, 63(9), 103980-103980 (2020-06-13)
To date 45 autosomal recessive disease-causing variants are reported in the FKBP10 gene. Those variant were found to be associated with Osteogenesis Imperfecta (OI) for which the hallmark phenotype is bone fractuers or Bruck Syndrome (BS) where bone fractures are
Bruck syndrome - a rare syndrome of bone fragility and joint contracture and novel homozygous FKBP10 mutation.
Moravej H, et. Al
Endokrynologia Polska, 66(2), 170-174 (2015)
Integration of zebrafish fin regeneration genes with expression data of human tumors in silico uncovers potential novel melanoma markers
Martin Hagedorn
Oncotarget, 7(44), 71567?71579-71567?71579 (2016)
Michael C J Quinn et al.
International journal of oncology, 42(3), 912-920 (2013-01-29)
The frequent loss of chromosome 17 in epithelial ovarian carcinomas (EOC), particularly high-grade serous carcinomas (HGSC), has been attributed to the disruption of TP53 (at 17p13.1) and other chromosome 17 genes suspected to play a role in tumour suppressor pathways.

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico