Synthetic peptide directed towards the N terminal region of human TMEM149
Aplicación
Anti-TMEM149 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Acciones bioquímicas o fisiológicas
TMEM149, renamed as IGF-like family receptor 1 (IGFLR1) is expressed on the surface of T cells and may influence T cell biology and inflammation.
Secuencia
Synthetic peptide located within the following region: WRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWP
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
The Journal of biological chemistry, 286(21), 18969-18981 (2011-04-02)
Psoriasis is a human skin condition characterized by epidermal hyperproliferation and infiltration of multiple leukocyte populations. In characterizing a novel insulin growth factor (IGF)-like (IGFL) gene in mice (mIGFL), we found transcripts of this gene to be most highly expressed
Questions
Reviews
★★★★★ No rating value
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.