Synthetic peptide directed towards the C terminal region of human TCEB3
Application
Anti-TCEB3 antibody produced in rabbit is suitable for western blotting at a working concentration of 7.5 μg/ml. The recommended concentration for immunohistochemistry of paraffin-embedded tissue sections is 4-8 μg/ml.
Biochem/physiol Actions
Transcription elongation factor b mediates crosstalk between RNA processing factors, transcription apparatus and the chromatin. This crosstalk results in transcription elongation and optimum production of mRNA.
Sequence
Synthetic peptide located within the following region: AYDGPSTSSAHLAPVVSSTVSYDPRKPTVKKIAPMMAKTIKAFKNRFSRR
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Promoter-proximal pausing of RNA polymerase II (RNAPII) across the genome has renewed our attention to the early transcriptional events that control the establishment of pausing and the release of RNAPII into a productive transcription elongation. Here, we review our current
Questions
Reviews
★★★★★ No rating value
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.