Skip to Content
Merck
All Photos(1)

Key Documents

SAB2101711

Sigma-Aldrich

Anti-PAM antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-PAL, Anti-PHM, Anti-Peptidylglycine α-amidating monooxygenase

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

Pricing and availability is not currently available. Contact Technical Service

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

108 kDa

species reactivity

guinea pig, horse, rabbit, bovine, mouse, human, rat

concentration

0.5 mg - 1 mg/mL

General description

The previously assigned protein identifier A6NMR0 has been merged into P19021. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the N terminal region of human PAM

Biochem/physiol Actions

PAM is a multifunctional protein. It has two enzymatically active domains with catalytic activities-peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products.This gene encodes a multifunctional protein. It has two enzymatically active domains with catalytic activities - peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene but some of their full length sequences are not yet known.

Sequence

Synthetic peptide located within the following region: PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Articles

Phase I biotransformation reactions increase drug compound polarity, mainly occurring in hepatic circulation.

Phase I biotransformation reactions increase drug compound polarity, mainly occurring in hepatic circulation.

Phase I biotransformation reactions increase drug compound polarity, mainly occurring in hepatic circulation.

Phase I biotransformation reactions increase drug compound polarity, mainly occurring in hepatic circulation.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service