Skip to Content
MilliporeSigma
All Photos(2)

Documents

HPA026809

Sigma-Aldrich

Anti-SIRT3 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-SIR2L3, Anti-sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae)

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

FSVGASSVVGSGGSSDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYT

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SIRT3(23410)

General description

Sirtuin 3 (SIRT3) is a 399 amino acid protein, which belongs to the Sirtuins (SIRTs), a family of nicotinamide adenine dinucleotide (NAD+)-dependent deacetylases. Increased expression of SIRT3 is connected with extended lifespan of humans. SIRT3 gene is mapped to human chromosome 11p15.5. The protein is characterized with N-terminal mitochondrial targeting signal and a central catalytic domain. SIRT3 is expressed in several tissues including adipose tissue, brain and heart in both fetus and adults. It is also referred to as SIR2L3 (SIR2-like protein 3).

Immunogen

sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae) recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Sirtuin 3 (SIRT3) plays a vital role in the regulation of enzymes involved in various cellular pathways, such as respiratory chain, ATP synthesis, β-oxidation, tricarboxylic acid cycle and urea cycle, and decreases concentration of reactive oxygen species (ROS) and oxidative stress. SIRT3 is a novel gene involved in human ageing, therefore any abnormalities in the gene leads to several age-related diseases, such as cancer, metabolic syndrome, cardiovascular disease, and neurodegenerative diseases. SIRT3 facilitates mitochondrial function and metabolism. Sirt3 modulates energy homeostasis via regulation of basal ATP levels.3 Inhibition of SIRT3 by LC-0296, might facilitate the development of new targeted therapies to treat patients with head and neck cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70480

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Variability of the SIRT3 gene, human silent information regulator Sir2 homologue, and survivorship in the elderly.
Rose G
Experimental Gerontology, 38(10), 1065-1070 (2003)
A Novel Sirtuin-3 Inhibitor, LC-0296, Inhibits Cell Survival and Proliferation, and Promotes Apoptosis of Head and Neck Cancer Cells.
Alhazzazi TY
Anticancer Research, 36(1), 49-60 (2016)
Genetic and Functional Sequence Variants of the SIRT3 Gene Promoter in Myocardial Infarction.
Yin X
PLoS ONE, 11(4) (2016)
Isha Sharma et al.
Biomedicines, 8(7) (2020-07-28)
Obesity is associated with perturbations in cellular energy homeostasis and consequential renal injury leading to chronic renal disease (CKD). Myo-inositol oxygenase (MIOX), a tubular enzyme, alters redox balance and subsequent tubular injury in the settings of obesity. Mechanism(s) for such

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service