HPA005908
Anti-UCHL5 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-UCH-L5, Anti-Ubiquitin C-terminal hydrolase UCH37, Anti-Ubiquitin carboxyl-terminal hydrolase isozyme L5, Anti-Ubiquitin thioesterase L5
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunohistochemistry: 1:200- 1:500
immunogen sequence
CTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKT
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... UCHL5(51377)
General description
Ubiquitin C-terminal hydrolase L5 (UCHL5), a cysteine protease, is an integral part of the protein homeostasis network. It belongs to the family of ubiquitin C-terminal hydrolases (UCHs). UCHL5 is a proteasome-associated deubiquitinating enzyme, that is ubiquitously expressed in most of the normal human tissues. UCHL5 gene is located on human chromosome 1q31.2.
Immunogen
Ubiquitin carboxyl-terminal hydrolase isozyme L5 recombinant protein epitope signature tag (PrEST)
Application
Anti-UCHL5 antibody produced in rabbit has been used in immunohistochemistry(1:800).
Biochem/physiol Actions
Ubiquitin C-terminal hydrolase L5 (UCHL5) is considered a new prognostic marker in rectal cancer and pancreatic ductal adenocarcinoma. UCHL5 along with Rpn13 plays a key role in maintaining the progression of cell-cycle and DNA replication. It is necessary for effective polyubiquitin removal from proteasomal substrates, which leads to proteasomal substrate breakdown. The absence of UCHL5 may also inhibit the degradation of specific substrates, resulting in apoptosis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST70227
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Leena Arpalahti et al.
PloS one, 13(2), e0193125-e0193125 (2018-02-24)
Gastric cancer is the second most common cause of cancer-related mortality worldwide. Accurate prediction of disease progression is difficult, and new biomarkers for clinical use are essential. Recently, we reported that the proteasome-associated deubiquitinating enzyme UCHL5/Uch37 is a new prognostic
Shiho Fukui et al.
Oncotarget, 10(57), 5932-5948 (2019-11-02)
The ubiquitin-proteasome pathway plays an important role in the regulation of cellular proteins. As an alternative to the proteasome itself, recent research has focused on methods to modulate the regulation of deubiquitinating enzymes (DUBs) upstream of the proteasome, identifying DUBs
Leena Arpalahti et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 39(6), 1010428317710411-1010428317710411 (2017-06-28)
Pancreatic ductal adenocarcinoma is a lethal disease with an overall 5-year survival of less than 5%. Prognosis among surgically treated patients is difficult and identification of new biomarkers is essential for accurate prediction of patient outcome. As part of one
Leena Arpalahti et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 39(7), 1010428317716078-1010428317716078 (2017-07-07)
Colorectal cancer is among the three most common cancer types for both genders, with a rising global incidence. To date, prognostic evaluation is difficult and largely dependent on early detection and successful surgery. UCHL5/Uch37 is an integral part of the
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service