HPA026864
Anti-VDAC3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-Outer mitochondrial membrane protein porin 3, Anti-VDAC-3, Anti-Voltage-dependent anion-selective channel protein 3, Anti-hVDAC3
Sign Into View Organizational & Contract Pricing
All Photos(2)
About This Item
UNSPSC Code:
12352203
Human Protein Atlas Number:
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunofluorescence: 1-4 μg/mL
immunohistochemistry: 1:20- 1:50
immunogen sequence
TSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTH
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... VDAC3(7419)
General description
Voltage dependent anion channel 3 (VDAC3) is encoded by the gene mapped to human chromosome 8p11.2. The protein is predominantly expressed in testis. The protein consists of disulfide bridges with cysteine residues present on the barrel and exposed to the mitochondrial inter-membrane space.[1]
Immunogen
Voltage-dependent anion-selective channel protein 3 recombinant protein epitope signature tag (PrEST)
Application
Anti-VDAC3 antibody produced in rabbit has been used in western blotting.[1] All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
The human voltage dependent anion channel 3 (VDAC3) might be involved in the metabolism of cholesterol for steroidogenesis. VDAC3 functions as a pore-forming protein and regulates metabolite flux between mitochondria and cytoplasm. Channel gating of VDAC3 can be regulated via redox sensing under physiological conditions. In male mice, loss of VDAC3 leads to infertility.[2] VDAC3 present at the maternal centriole controls centriole assembly by linking Mps1 to the centrosome.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST86796.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Lot/Batch Number
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Immotile sperm and infertility in mice lacking mitochondrial voltage-dependent anion channel type 3.
The Journal of Biological Chemistry, 276(42), 39206-39212 (2001)
A computational study of ion current modulation in hVDAC3 induced by disulfide bonds.
Guardiani C
Biochimica et Biophysica Acta, 1858(4), 813-823 (2016)
Isolation of a novel human voltage-dependent anion channel gene.
Rahmani Z
European Journal of Human Genetics, 6(4), 337-340 (1998)
Mia Ydfors et al.
The Journal of physiology, 594(11), 3127-3140 (2015-12-04)
Mitochondrial respiratory sensitivity to ADP is thought to influence muscle fitness and is partly regulated by cytosolic-mitochondrial diffusion of ADP or phosphate shuttling via creatine/phosphocreatine (Cr/PCr) through mitochondrial creatine kinase (mtCK). Previous measurements of respiration in vitro with Cr (saturate
Masateru Okazaki et al.
Biochimica et biophysica acta, 1848(12), 3188-3196 (2015-09-27)
The voltage-dependent anion channels (VDACs), VDAC1, VDAC2, and VDAC3, are pore-forming proteins that control metabolite flux between mitochondria and cytoplasm. VDAC1 and VDAC2 have voltage-dependent gating activity, whereas VDAC3 is thought to have weak activity. The aim of this study
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service
