HPA025941

Anti-DDX42 antibody produced in rabbit

Name: Anti-DDX42 antibody produced in rabbit
Brand: SIGMA
Price: 615 USD

affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-RHELP, Anti-RNAHP, Anti-SF3B8, Anti-SF3b125

Slide 1 of 5

Select a Size

100 μL

$615.00

Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

About This Item

UNSPSC Code:

12352203

NACRES:

NA.43

Human Protein Atlas Number:

HPA025941

Key Documents

View All Documentation

Product Name

Anti-DDX42 antibody produced in rabbit, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

TAGVVQEEEEDNLEYDSDGNPIAPTKKIIDPLPPIDHSEIDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLNLRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQG

UniProt accession no.

Q86XP3

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	HPA023447	AV36438	HPA031381
Sigma-Aldrich HPA025941 Anti-DDX42 antibody produced in rabbit	Sigma-Aldrich HPA023447 Anti-DDX42 antibody produced in rabbit	$Anti-DDX41 antibody produced in rabbit IgG fraction of antiserum$ Sigma-Aldrich AV36438 Anti-DDX41 antibody produced in rabbit	Sigma-Aldrich HPA031381 Anti-DDX43 antibody produced in rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form IgG fraction of antiserum	antibody form affinity isolated antibody
shipped in wet ice	shipped in wet ice	shipped in wet ice	shipped in wet ice
form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous solution	form buffered aqueous glycerol solution

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

The gene DDX42 (DEAD-box helicase 42) encodes a component of 17S U2 snRNP splicing complex. It is found to associate with the Japanese encephalitis virus (JEV) NS4A (nonstructural protein 4A) protein. This interaction inhibits the stimulation of an innate immune response to JEV infection. The C-terminal tail of the protein interacts with ASPP2 (apoptosis-stimulating protein of p53 2) and regulates its apoptosis-stimulating properties.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

General description

The gene DDX42 (DEAD-box helicase 42) belongs to the Asp-Glu-Ala-Asp (DEAD) box protein family. The DEAD-box proteins contain nine conserved motifs that function in the regulation of ATPase and helicase activities. They participate in all RNA-related processes, including transcription and decay.

Immunogen

ATP-dependent RNA helicase DDX42 recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST75972

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

R12266

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

DEAD-box helicases: posttranslational regulation and function.

Gustafson EA and Wessel GM

Biochemical and Biophysical Research Communications, 395, 1-6 (2010)

The DEAD-box protein family of RNA helicases.

Cordin O

Gene, 367, 17-37 (2006)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service