Skip to Content
MilliporeSigma
All Photos(6)

Documents

HPA023879

Sigma-Aldrich

Anti-ARID5A antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ARID domain-containing protein 5A, Anti-AT-rich interactive domain-containing protein 5A, Anti-MRF-1, Anti-Modulator recognition factor 1

Sign Into View Organizational & Contract Pricing
All Photos(6)

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA023879
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500

immunogen sequence

LVLPYVRHLKGEDDKPLPTSKPRKQYKMAKENRGDDGATERPKKAKEERRMDQMMPGKTKADAADPAPLPSQEPPRNSTEQQGLASGSSVSFVGASGCPEAYKRLLSSFYCKGTH

UniProt accession no.

Q03989

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ARID5A(10865)

General description

AT-rich interactive domain (ARID)-containing protein 5A (Arid5a), also known as modulator recognition factor 1 (MRF1), is a member of ARID protein family. The protein consists of helix-turn-helix motif DNA-binding domain called ARID, which binds to specific AT-rich DNA sequences. Arid5a or MRF1 is highly expressed in aorta, heart, skeletal muscle, and liver. Chlorpromazine (CPZ) acts as an inhibitor of Arid5a.

Immunogen

AT-rich interactive domain-containing protein 5A recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

AT-rich interactive domain (ARID)-containing protein 5A (Arid5a), in association with transcription factor SRY-box containing gene 9 (Sox9), plays a role in activation of chondrocyte-specific transcription. It also takes part in stabilization of IL-6 mRNA. Arid5a, along with other members of ARID protein family, plays vital role in development, tissue specific gene expression and proliferation. Arid5a/modulator recognition factor 1 (MRF1)protein regulates ER-dependent gene expression in cardiovascular and other cells.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86209

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

P079 ARID5a is an IL-6 mRNA stability protein. Chlorpromazine mediates its inhibitory effect on IL-6 production in macrophages through inhibition of ARID5A expression
Masuda k
Cytokine, 59(3), 544-544 (2012)
Arid5a controls IL-6 mRNA stability, which contributes to elevation of IL-6 level in vivo.
Masuda k
Proceedings of the National Academy of Sciences of the USA, 110(23), 9409-9414 (2013)
Modulator recognition factor 1, an AT-rich interaction domain family member, is a novel corepressor for estrogen receptor alpha.
Georgescu SP
Molecular Endocrinology, 19(10), 2491-2501 (2005)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service