Key Documents

Anti-PPM1L antibody produced in rabbit

Name: Anti-PPM1L antibody produced in rabbit
Brand: SIGMA
Price: 2400 PLN

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Synonym(s):

Anti-PP2C-epsilon, Anti-Protein phosphatase 1-like, Anti-Protein phosphatase 1L, Anti-Protein phosphatase 2C isoform epsilon

Select a Size

Change View

Pack Size	SKU	Availability	Price
100 μL		Please contact Customer Service for Availability	PLN 2,400.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA019953

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IF, IHC

Citations:

PLN 2,400.00

Please contact Customer Service for Availability

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:20-1:50

immunogen sequence

DLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSK

UniProt accession no.

Q5SGD2

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PPM1L(151742)

Description

General description

PPM1L (Protein phosphatase, Mg2+/Mn2+ dependent 1L) is a novel serine-threonine phosphatase belonging to PP2C family.

Immunogen

Protein phosphatase 1L recombinant protein epitope signature tag (PrEST)

Application

Anti-PPM1L antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

PPM1L (Protein phosphatase, Mg²⁺/Mn²⁺ dependent 1L) is involved in the H₂O₂-induced regulation of ASK1 signaling. It suppresses gene expression of SAPK (stress-activated protein kinase) by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5. It is also associated with the regulation of the TGF-β and BMP (Bone Morphogenetic Protein) signaling pathways.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73644

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA019891	HPA061848	HPA016745
Sigma-Aldrich HPA019953 Anti-PPM1L antibody produced in rabbit	Sigma-Aldrich HPA019891 Anti-PPM1L antibody produced in rabbit	Sigma-Aldrich HPA061848 Anti-PPM1D antibody produced in rabbit	Sigma-Aldrich HPA016745 Anti-PPM1B antibody produced in rabbit
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
species reactivity human	species reactivity human	species reactivity human	species reactivity human

Still not finding the right product?

Explore all of our products under Anti-PPM1L antibody produced in rabbit

— or —

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

R10528

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Foxa1 and Foxa2 are essential for sexual dimorphism in liver cancer.

Zhaoyu Li et al.

Cell, 148(1-2), 72-83 (2012-01-24)

Hepatocellular carcinoma (HCC) is sexually dimorphic in both rodents and humans, with significantly higher incidence in males, an effect that is dependent on sex hormones. The molecular mechanisms by which estrogens prevent and androgens promote liver cancer remain unclear. Here

Regulation of apoptosis signal-regulating kinase 1 by protein phosphatase 2Cepsilon.

Jun-ichi Saito et al.

The Biochemical journal, 405(3), 591-596 (2007-04-26)

ASK1 (apoptosis signal-regulating kinase 1), a MKKK (mitogen-activated protein kinase kinase kinase), is activated in response to cytotoxic stresses, such as H2O2 and TNFalpha (tumour necrosis factor alpha). ASK1 induction initiates a signalling cascade leading to apoptosis. After exposure of

Genome-wide scan identifies a copy number variable region at 3q26 that regulates PPM1L in APC mutation-negative familial colorectal cancer patients.

L F Thean et al.

Genes, chromosomes & cancer, 49(2), 99-106 (2009-10-23)

Familial adenomatous polyposis (FAP) is an autosomal dominantly inherited form of colorectal cancer (CRC) caused by mutation in the adenomatous polyposis coli (APC) gene. However, APC mutations are not detected in 10-50% of FAP patients. We searched for a new

Global Trade Item Number

SKU	GTIN
HPA019953-100UL	04061835683833
HPA019953-25UL	04061841668206

Questions

Reviews

No rating value