HPA018192

Anti-NLK antibody produced in rabbit

Name: Anti-NLK antibody produced in rabbit
Brand: SIGMA
Price: 529 CHF

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Nemo-like kinase, Anti-Protein LAK1, Anti-Serine/threonine kinase NLK

Slide 1 of 2

Se connecter pour consulter les tarifs organisationnels et contractuels.

Sélectionner une taille de conditionnement

100 μL

529.00 CHF

Vérifier la disponibilité des articles du panier

A propos de cet article

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA018192

Principaux documents

Voir toute la documentation

Passer à

Service technique

Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.

Laissez-nous vous aider

Nom du produit

Anti-NLK antibody produced in rabbit, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
western blot: 0.04-0.4 μg/mL

immunogen sequence

LRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPS

UniProt accession no.

Q9UBE8

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NLK(51701)

Catégories apparentées

Enhanced Validation Antibodies

Prestige Antibodies^® Powered by Atlas Antibodies

Antibodies - Primary, Secondary & Recombinant Monoclonal

Protein Biology

Comparer avec des articles similaires

Voir la comparaison complète

Montrer les différences

1 of 4

Cet article	HPA015757	HPA016431	HPA008026
Sigma-Aldrich HPA018192 Anti-NLK antibody produced in rabbit	Sigma-Aldrich HPA015757 Anti-SLK antibody produced in rabbit	Sigma-Aldrich HPA016431 Anti-SRPK1 antibody produced in rabbit	Sigma-Aldrich HPA008026 Anti-STK40 antibody produced in rabbit
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
shipped in wet ice	shipped in wet ice	shipped in wet ice	shipped in wet ice
UniProt accession no. Q9UBE8	UniProt accession no. Q9H2G2	UniProt accession no. Q96SB4	UniProt accession no. Q8N2I9

Immunogen

Serine/threonine kinase NLK recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST73478

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Vous ne trouvez pas le bon produit ?

Essayez notre Outil de sélection de produits.

Classe de stockage

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

A78434

R07832

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Inhibition of nemo-like kinase increases taxol sensitivity in laryngeal cancer.

Ji-Rui Dong et al.

Asian Pacific journal of cancer prevention : APJCP, 14(12), 7137-7141 (2014-01-28)

Several studies have shown that nemo-like kinase (NLK) plays a vital role in apoptosis of cancer cells. The present research concerned effects and mechanisms of Taxol on NLK knockdown human laryngeal cancerHep-2 cell lines in vitro. Using RNAi, methyl-thiazoltetrazolium (MTT)

NLK functions to maintain proliferation and stemness of NSCLC and is a target of metformin.

Dong Suwei et al.

Journal of hematology & oncology, 8, 120-120 (2015-10-28)

Nemo-like kinase (NLK) is an evolutionarily conserved serine/threonine kinase that regulates the activity of a wide range of signal transduction pathways. Metformin, an oral antidiabetic drug, is used for cancer prevention. However, the significance and underlying mechanism of NLK and

Contenu apparenté

Procedure for Fixation Immunostaining and Imaging in 384-well Plates

Prestige Antibodies Immunofluorescence Procedure

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique