Skip to Content
MilliporeSigma
All Photos(3)

Documents

HPA018132

Sigma-Aldrich

Anti-ZNHIT6 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Serologically defined breast cancer antigen NY-BR-75, Anti-Zinc finger HIT domain-containing protein 6

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

KEELMHGECVKEEKDFLKKEIVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCNGVRDKTAYISIQQFTEMNLL

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ZNHIT6(54680)

General description

The gene has been mapped to human chromosome 1p22.3. Zinc finger HIT domain-containing protein-6 (ZNHIT6) encodes for a zinc finger protein, zinc finger HIT domain-containing protein-6.

Immunogen

Zinc finger HIT domain-containing protein 6 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Zinc finger HIT domain-containing protein-6 (ZNHIT6) is an assembly factor which participates in the complex required for small nucleolar RNA (snoRNA) accumulation, processing and nucleolar localization. The protein associates with U3 and U8 pre-snoRNA. RNAi-mediated depletion of ZNHIT6 results in a significant reduction of U3, U8 and U14 snoRNA levels in HeLa cells. Pull down assay showed ZNHIT6 interaction with nucleolar protein 58 (NOP58), nuclear FMRP-interacting protein 1 (NUFIP), transcription initiation factor TFIID subunit-9 (TAF9), TATA box-binding protein-interacting protein (TIP48, TIP49 - interaction regulated by binding and hydrolysis of ATP) and fibrillarin. Additionally, co-immunoprecipitation and yeast two hybrid revealed ZNHIT6 interaction with zinc finger HIT domain-containing protein-3 (ZNHIT3). Double homeobox protein-4 (DUX4), a transcription factor, which is a leading candidate of facioscapulohumeral dystrophy (FSHD) induces the expression of ZNHIT6.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73695

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Michael E Talkowski et al.
Cell, 149(3), 525-537 (2012-04-24)
Balanced chromosomal abnormalities (BCAs) represent a relatively untapped reservoir of single-gene disruptions in neurodevelopmental disorders (NDDs). We sequenced BCAs in patients with autism or related NDDs, revealing disruption of 33 loci in four general categories: (1) genes previously associated with
A dynamic scaffold of pre-snoRNP factors facilitates human box C/D snoRNP assembly.
McKeegan KS
Molecular and Cellular Biology, 27, 6782-6793 (2007)
Jonathan Bizarro et al.
The Journal of cell biology, 207(4), 463-480 (2014-11-19)
In vitro, assembly of box C/D small nucleolar ribonucleoproteins (snoRNPs) involves the sequential recruitment of core proteins to snoRNAs. In vivo, however, assembly factors are required (NUFIP, BCD1, and the HSP90-R2TP complex), and it is unknown whether a similar sequential
Linda N Geng et al.
Developmental cell, 22(1), 38-51 (2012-01-03)
Facioscapulohumeral dystrophy (FSHD) is one of the most common inherited muscular dystrophies. The causative gene remains controversial and the mechanism of pathophysiology unknown. Here we identify genes associated with germline and early stem cell development as targets of the DUX4

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service