HPA017287

Anti-SSB antibody produced in rabbit

Name: Anti-SSB antibody produced in rabbit
Brand: SIGMA
Price: 519 EUR
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Slide 1 of 4

Anmelden zur Ansicht der Organisations- und Vertragspreise.

Größe auswählen

100 μL

519,00 €

Ab HEUTE lieferbarDetails

Über diesen Artikel

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA017287

Wichtige Dokumente

Gesamtdokumentation anzeigen

Fortfahren mit

Technischer Dienst

Benötigen Sie Hilfe? Unser Team von erfahrenen Wissenschaftlern ist für Sie da.

Unterstützung erhalten

Produktname

Anti-SSB antibody produced in rabbit, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, rat, human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

AKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDD

UniProt accession no.

P05455

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

100

Gene Information

human ... SSB(6741)

Ähnliche Artikel vergleichen

Vollständigen Vergleich anzeigen

Unterschiede anzeigen

1 of 4

Dieser Artikel	SAB4502858	HPA011897	SAB3500729
Sigma-Aldrich HPA017287 Anti-SSB antibody produced in rabbit	Sigma-Aldrich SAB4502858 Anti-SSB antibody produced in rabbit	Sigma-Aldrich HPA011897 Anti-SI antibody produced in rabbit	Sigma-Aldrich SAB3500729 Anti-TSN antibody produced in rabbit
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -
UniProt accession no. P05455	UniProt accession no. P05455	UniProt accession no. P14410	UniProt accession no. Q15631

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

SSB (sjogren syndrome antigen B) is a 47kDa autoimmune RNA-binding protein consisting of two structural domains. It is involved in the transcription of RNA polymerase III. It acts as a transcription termination factor in facilitating the termination process, followed by binding of resulting RNA product. It has been reported that the protein may be involved in the autoimmune response.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Immunogen

Lupus La protein recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST72516

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sie haben nicht das passende Produkt gefunden?

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklasse

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

R06961

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Suche nach COA

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

Genomic structure and amino acid sequence domains of the human La autoantigen.

J C Chambers et al.

The Journal of biological chemistry, 263(34), 18043-18051 (1988-12-05)

La is an autoimmune RNA-binding protein of 47 kDa that plays a role in the transcription of RNA polymerase III. Both genomic and complementary DNAs were isolated that encompass the coding sequence of the human La molecule. The genomic clones

Function of the mammalian La protein: evidence for its action in transcription termination by RNA polymerase III.

E Gottlieb et al.

The EMBO journal, 8(3), 851-861 (1989-03-01)

We have tested the hypothesis that the mammalian La protein, which appears to be required for accurate and efficient RNA polymerase III transcription, is a transcription termination factor. Our data suggest that 3' foreshortened transcripts generated in La's absence are

Fragen

Bewertungen

Kein Beurteilungswert

Aktive Filter

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung