Skip to Content
MilliporeSigma
All Photos(1)

Documents

HPA014849

Sigma-Aldrich

Anti-KCNE3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-MinK-related peptide 2, Anti-Minimum potassium ion channel-related peptide 2, Anti-Potassium channel subunit beta MiRP2, Anti-Potassium voltage-gated channel subfamily E member 3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:1000- 1:2500

immunogen sequence

METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDN

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... KCNE3(10008)

General description

KCNE3 (potassium channel, voltage gated subfamily E regulatory β subunit 3) encodes the β subunit of potassium channel, which associates with multiple α subunits, to form a channel complex. This gene is localized to human chromosome 11q13-14, and is expressed in brain, inner ear and heart. It belongs to the KCNE family, which contains five members, from KCNE1-5.

Immunogen

Potassium voltage-gated channel subfamily E member 3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

KCNE3 (potassium channel, voltage gated subfamily E regulatory β subunit 3) interacts with KCNE1, to control the transport, surface expression and activation of KCNH3, a potassium channel, in cortex and other regions of the central nervous system (CNS). Its chromosomal location is the locus for autosomal recessive, non-syndromal hearing disorder. It acts as an inhibitory β- subunit, and regulates the activity of Kv4.3 channel. Mutation in this gene is associated with Brugada-pattern electrocardiogram (ECG) and neurally mediated syncope (NMS). Thus, it might have some role in the pathogenesis of Brugada syndrome (BrS). Variants in this gene are also linked to long QT syndrome (LQTS), which is an inherited disorder. This protein also interacts with Kv7.1, which results in acceleration in the activation and decay of the current.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72451

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Seiko Ohno et al.
Human mutation, 30(4), 557-563 (2009-03-24)
Long QT syndrome (LQTS) is an inherited disease involving mutations in the genes encoding a number of cardiac ion channels and a membrane adaptor protein. Among the genes that are responsible for LQTS, KCNE1 and KCNE2 are members of the
Eva Delpón et al.
Circulation. Arrhythmia and electrophysiology, 1(3), 209-218 (2009-01-06)
The Brugada Syndrome (BrS), an inherited syndrome associated with a high incidence of sudden cardiac arrest, has been linked to mutations in four different genes leading to a loss of function in sodium and calcium channel activity. Although the transient
Philipp G Sand et al.
Behavioral and brain functions : BBF, 7, 39-39 (2011-09-09)
Membrane-stabilizing drugs have long been used for the treatment of chronic tinnitus, suggesting an underlying disturbance of sensory excitability due to changes in ion conductance. The present study addresses the potassium channel subunit gene KCNE3 as a potential candidate for
Tadashi Nakajima et al.
Circulation journal : official journal of the Japanese Circulation Society, 76(12), 2763-2772 (2012-09-19)
Brugada syndrome (BrS) is genetically heterogeneous. In Japanese BrS patients, except for SCN5A and KCNE5, mutations in the responsible genes have not yet been identified, and therefore the genetic heterogeneity remains poorly elucidated. Forty consecutive patients with Brugada-pattern electrocardiogram (ECG)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service