Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
5
biological source
rabbit
Quality Segment
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:20-1:50
immunogen sequence
EPLLEIDGDIRNFEVFLSSRTPVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISIGGLAYPPLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVS
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... KIDINS220(57498)
General description
KIDINS220 (kinase D-interacting substrate, 220kDa) is a newly discovered protein, which has a predominant expression in the developing nervous system. This gene is localized to human chromosome 2q. The encoded protein is of 22kDa, and is composed of three functional domains. One domain acts as a scaffold for MAPK/ERK (extracellular signal-regulated kinase (ERK) kinase) signaling cascade, and also interacts with Trk, Eph, and VEGF (vascular endothelial growth factor). It has a kinesin binding domain, which also interacts with microtubule associated proteins (MAPs). The last domain is an ankyrin rich domain, present in the N-terminal and interacts with Trio, which is a RhoGEF. It has four transmembrane regions, and both N- and C-termini face the cytoplasm.
Immunogen
Ankyrin repeat-rich membrane spanning protein recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
KIDINS220 (kinase D-interacting substrate, 220kDa) is a ligand for tyrosine kinase receptors in neurons. It plays an essential role in the development and survival of neurons, by mediating neurotrophic signaling. It is expressed in neuroblastoma and facilitates neuroblastoma cell survival, through nerve growth factor (NGF)-mediated signaling. In neural crest tumors, it is responsible for the neuroblastic (N-type) cell to Schwannian stromal (S-type) cell transition. It is also up-regulated in melanoma, and facilitates melanoma migration and invasiveness via, extracellular signal-regulated kinase (ERK) (MEK)/ERK signaling pathway. It is hypothesized that KIDINS220 plays a role in regulating cytoskeleton dynamics, thus affecting cell movement in both pathological and normal conditions. Excitotoxicity and cerebral ischaemia lead to suppression of this protein, which results in neuronal death. In Alzheimer′s disease (AD), KIDINS220 accumulates along with tau protein, due to resistance to calpain processing. Thus, it has potential as a therapeutic target in AD.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST73113
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Global Trade Item Number
| SKU | GTIN |
|---|---|
| HPA014790-25UL | 04061842804122 |
| HPA014790-100UL | 04061835680634 |