Skip to Content
MilliporeSigma
All Photos(2)

Documents

HPA014742

Sigma-Aldrich

Anti-SYNGR2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-synaptogyrin 2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQP

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SYNGR2(9144)

General description

SYNGR2 (synaptogyrin 2) belongs to the synaptogyrin protein family, which consists of three members- SYNGR1-3. This protein has a wide range of tissue expression, except for brain. It is a membrane protein, and contains four conserved transmembrane regions. In adipose tissues, cardiomyocytes and skeletal muscles, it co-localizes with Glut4 (glucose transporter).

Immunogen

synaptogyrin 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

The exact function of SYNGR2 (synaptogyrin 2) is not fully characterized. However, it is tyrosine phosphorylated at its C-terminal, and might be involved in controlling membrane trafficking in non-neuronal cells. Studies performed on PC12 cell lines show that SYNGR2 is capable of inducing the production of synaptic-like microvesicles (SLMVs). It facilitates membrane curvature, by assuming an inverted cone form, which aids in the budding of the donor membrane. SYNGR2-positive vesicles are thought to be involved in vesicle transport intracellularly, and phosphatidylinositol 4-Kinase Type IIα (PI4K type IIα) is only targeted to such vesicles. PI4K type IIα is responsible for the activity of phosphatidylinositol 4-kinase in relation to Glut4 (glucose transporter). It is also responsible for the transport of Glut4 in response to insulin, and is present in the vesicles that shuttle Glut4 between recycling and sorting endosomes.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73100

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

T A Kupriyanova et al.
The Journal of biological chemistry, 275(46), 36263-36268 (2000-09-01)
Although Glut4 traffic is routinely described as translocation from an "intracellular storage pool" to the plasma membrane, it has been long realized that Glut4 travels through at least two functionally distinct intracellular membrane compartments on the way to and from
Gabriel M Belfort et al.
The Journal of biological chemistry, 280(8), 7262-7272 (2004-12-14)
The four-transmembrane domain proteins synaptophysin and synaptogyrin represent the major constituents of synaptic vesicles. Our previous studies in PC12 cells demonstrated that synaptogyrin or its nonneuronal paralog cellugyrin targets efficiently to synaptic-like microvesicles (SLMVs) and dramatically increases the synaptophysin content
D Kedra et al.
Human genetics, 103(2), 131-141 (1998-10-06)
Genomic sequencing was combined with searches of databases for identification of active genes on human chromosome 22. A cosmid from 22q13, located in the telomeric vicinity of the PDGFB (platelet-derived growth factor B-chain) gene, was fully sequenced. Using an expressed
R Janz et al.
The Journal of biological chemistry, 273(5), 2851-2857 (1998-02-28)
Synaptogyrin is an abundant membrane protein of synaptic vesicles containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. We have now identified a novel isoform of synaptogyrin called cellugyrin that exhibits 47% sequence identity with synaptogyrin.
Gabriel M Belfort et al.
The Journal of biological chemistry, 278(48), 47971-47978 (2003-08-21)
Cellugyrin represents a ubiquitously expressed four-transmembrane domain protein that is closely related to synaptic vesicle protein synaptogyrin and, more remotely, to synaptophysin. We report here that, in PC12 cells, cellugyrin is localized in synaptic-like microvesicles (SLMVs), along with synaptogyrin and

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service