Przejdź do zawartości
Merck

HPA014562

Anti-STARD9 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):

Anti-ANK, Anti-CCAL2, Anti-CPPDD, Anti-HANK, Anti-KIAA1300, Anti-StAR-related lipid transfer (START) domain containing 9

Zaloguj się, aby wyświetlić ceny organizacyjne i kontraktowe.

Wybierz wielkość

Zmień widok

Informacje o tej pozycji

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
2
Pomoc techniczna
Potrzebujesz pomocy? Nasz zespół doświadczonych naukowców chętnie Ci pomoże.
Pozwól nam pomóc


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

GMYSEPLRQFRDSSVGDQNAQVCQTNPEPPATTQGPHTLDLSEGSAESKLVVEPQHECLENTTRCFLEKPQFSTELRDHNRLDSQAKFVARLKHTCSPQEDSPWQEEEQHRDQASGGGE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... STARD9(57519)

General description

STARD9 (steroidgenic acute regulatory protein-related lipid transfer (START) domain containing 9) belongs to the kinesin-3 family of proteins. It has three putative isoforms, with the largest composed of 4,614 amino acids and a predicted molecular weight of 506.7kDa. It has a START domain at its C-terminal, and also contains PX domain. It also shares the conserved motor and FHA domains with the other family members. The loop 12 of this protein contains a unique 26-amino acid insert. It is widely expressed in human organs such as in, brains, heart and skin. This gene is localized to human chromosome 15q15, and has a 9483bp coding sequence.

Immunogen

StAR-related lipid transfer (START) domain containing 9 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

STARD9 (steroidgenic acute regulatory protein-related lipid transfer (START) domain containing 9) in involved in cancer cell division. Studies suggest that during bipolar spindle assembly, this protein is responsible for the stabilization of pericentriolar material (PCM). This is achieved by associating PCM with the daughter centriole. The motor domain of STARD9 has both microtubule-binding and ATPase activity, which are essential for the localization of centriole. Cells with decreased STARD9 levels undergo rapid apoptosis. Cells treated with anti-cancer drug taxol show depleted STARD9 levels, and therefore, this protein might have potential as a chemotherapeutic target.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST72679

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.


Still not finding the right product?

Wypróbuj nasze narzędzie Narzędzie selektora produktów, aby zawęzić opcje.


Klasa składowania

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable



Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów



Jorge Z Torres et al.
Cell, 147(6), 1309-1323 (2011-12-14)
During cell division, cells form the microtubule-based mitotic spindle, a highly specialized and dynamic structure that mediates proper chromosome transmission to daughter cells. Cancer cells can show perturbed mitotic spindles and an approach in cancer treatment has been to trigger
Niels Halama et al.
International journal of molecular medicine, 18(4), 653-656 (2006-09-12)
StAR (steroidogenic acute regulatory) proteins and proteins with StAR-related lipid transfer (START) domains are involved in lipid transport and metabolism, signal transduction, and transcriptional regulation. In this present study we characterized the StARD9 gene by bioinformatical methods. The human StARD9



Numer pozycji handlu globalnego

SKUNUMER GTIN
HPA014562-100UL04061836321550
HPA014562-25UL04061842793723