HPA009647

Anti-LDLR antibody produced in rabbit

Name: Anti-LDLR antibody produced in rabbit
Brand: SIGMA
Price: 493 EUR
Availability: InStock

Ab1, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(e):

Anti-LDLCQ2

Slide 1 of 4

Anmelden zur Ansicht der Organisations- und Vertragspreise.

Größe auswählen

100 μL

493,00 €

Ab HEUTE lieferbarDetails

Über diesen Artikel

UNSPSC Code:

12352203

Human Protein Atlas Number:

HPA009647

NACRES:

NA.43

MDL number:

MFCD00282350

Wichtige Dokumente

Gesamtdokumentation anzeigen

Fortfahren mit

Technischer Dienst

Benötigen Sie Hilfe? Unser Team von erfahrenen Wissenschaftlern ist für Sie da.

Unterstützung erhalten

Produktname

Anti-LDLR antibody produced in rabbit, Ab1, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

RTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSV

UniProt accession no.

P01130

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

100

Gene Information

human ... LDLR(3949)

Suchen Sie nach ähnlichen Produkten? Aufrufen Leitfaden zum Produktvergleich

Ähnliche Artikel vergleichen

Vollständigen Vergleich anzeigen

Unterschiede anzeigen

1 of 4

Dieser Artikel	SAB1406079	HPA003714	HPA012606
Sigma-Aldrich HPA009647 Anti-LDLR antibody produced in rabbit	Sigma-Aldrich SAB1406079 Anti-LDLR antibody produced in mouse	Sigma-Aldrich HPA003714 Anti-HDAC6 antibody produced in rabbit	Sigma-Aldrich HPA012606 Anti-NRCAM antibody produced in rabbit
biological source rabbit	biological source mouse	biological source rabbit	biological source rabbit
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
antibody form affinity isolated antibody	antibody form purified immunoglobulin	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
technique(s) immunohistochemistry: 1:20- 1:50	technique(s) western blot: 1 μg/mL	technique(s) immunohistochemistry: 1:50- 1:200	technique(s) immunohistochemistry: 1:20- 1:50

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

In liver and peripheral tissues, LDLR (low density lipoprotein receptor) plays a predominant role in the internalization of LDL and VLDL (very LDL) remnants. It internalizes circulating LDL and VLDL in endosomes, which is then degraded by lysosomes, whereas the receptor is recycled to cell surface. Polymorphisms in this gene are linked with familial hypercholesterolaemia (FH), which is an autosomal dominant disease, where the patients have elevated levels of low-density lipoprotein cholesterol (LDL-C).

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

General description

LDLR (low density lipoprotein receptor) is a transmembrane protein, which is composed of five structural domains- a ligand binding domain (LBD) in the N-terminal, an EGF (extracellular growth factor)-like domain, a small glycosylated domain, a transmembrane domain and a cytoplasmic domain present in the C-terminal, which is involved in localization and endocytosis of the LDLR.

Immunogen

Low-density lipoprotein receptor precursor recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST71915

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sie haben nicht das passende Produkt gefunden?

Probieren Sie unser Produkt-Auswahlhilfe. aus.

Lagerklasse

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Hier finden Sie alle aktuellen Versionen:

Analysenzertifikate (COA)

Lot/Batch Number

R02142

A08804

R002142

Die passende Version wird nicht angezeigt?

Wenn Sie eine bestimmte Version benötigen, können Sie anhand der Lot- oder Chargennummer nach einem spezifischen Zertifikat suchen.

Suche nach COA

Besitzen Sie dieses Produkt bereits?

In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.

Die Dokumentenbibliothek aufrufen

New Approaches in Detection and Treatment of Familial Hypercholesterolemia.

Merel L Hartgers et al.

Current cardiology reports, 17(12), 109-109 (2015-10-21)

Familial hypercholesterolemia (FH) is an autosomal dominant genetic disorder that clinically leads to increased low density lipoprotein-cholesterol (LDL-C) levels. As a consequence, FH patients are at high risk for cardiovascular disease (CVD). Mutations are found in genes coding for the

Functional analysis of four LDLR 5'UTR and promoter variants in patients with familial hypercholesterolaemia.

Amna Khamis et al.

European journal of human genetics : EJHG, 23(6), 790-795 (2014-09-25)

Familial hypercholesterolaemia (FH) is an autosomal dominant inherited disease characterised by increased low-density lipoprotein cholesterol (LDL-C) levels. The functionality of four novel variants within the LDLR 5'UTR and promoter located at c.-13A>G, c.-101T>C, c.-121T>C and c.-215A>G was investigated using in

The closed conformation of the LDL receptor is destabilized by the low Ca(++) concentration but favored by the high Mg(++) concentration in the endosome.

Juan Martínez-Oliván et al.

FEBS letters, 589(23), 3534-3540 (2015-11-04)

The LDL receptor (LDLR) internalizes LDL and VLDL particles. In the endosomes, it adopts a closed conformation important for recycling, by interaction of two modules of the ligand binding domain (LR4-5) and a β-propeller motif. Here, we investigate by SPR

Positive association between cholesterol in human seminal plasma and sperm counts: results from a cross-sectional cohort study and immunohistochemical investigations.

R de Neergaard et al.

Andrology, 6(6), 817-828 (2018-09-06)

Cholesterol is essential for cell membrane stability, permeability, and fluidity. Cholesterol is present in seminal plasma, but whether a relationship between the level of cholesterol in seminal plasma and semen quality exists remains to be elucidated. To explore the association

Fragen

Bewertungen

Kein Beurteilungswert

Aktive Filter

Unser Team von Wissenschaftlern verfügt über Erfahrung in allen Forschungsbereichen einschließlich Life Science, Materialwissenschaften, chemischer Synthese, Chromatographie, Analytik und vielen mehr..

Setzen Sie sich mit dem technischen Dienst in Verbindung