Skip to Content
MilliporeSigma
All Photos(2)

Documents

HPA009134

Sigma-Aldrich

Anti-PDGFC antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-BCS, Anti-BJS, Anti-Hs.6719, Anti-SCDGF, Anti-fallotein, Anti-h-BCS, Anti-platelet derived growth factor C

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

LDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVLQLRPKTGVRGLHKSLTDVA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PDGFC(56034)

General description

PDGFC (platelet derived growth factor C) gene localizes to human chromosome 4q31-q32. The encoded protein is a novel member of the PDGF family, and functions as a ligand for PDGFR-αα and PDGFR-αβ receptors. Humans contain four member of PDGF family, and PDGFC functions only as a homodimer. In tumor cells, this protein is expressed in the plasma membrane, cytosol and perinuclear area. It predominantly exists as the ~43 kDa non-SUMO1 modified form.

Immunogen

platelet derived growth factor C recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

PDGFC (platelet derived growth factor C) interacts with PDGFR-αα and PDGFR-αβ receptors, which leads to phosphorylation and eventual activation of the extracellular signal-regulated protein kinase/mitogen-activated protein kinase (Erk/MAPK) and Akt/PKB pathways. Through these pathways, this protein controls the maintenance and deposition of ECM (extracellular matrix) and also regulates cell survival, proliferation and migration. Studies in Chinese population suggest that this protein plays a role in the maternally inherited nonsyndromic cleft lip with or without palate. It is an essential component of neurovascular crosstalk, and functions as an angiogenic and a neuronal survival factor. The expression of PDGFC is negatively associated with lymphocyte infiltration in human papillary thyroid carcinomas. This protein plays an essential role in the growth of fibroid-derived smooth muscle cells (fSMCs) and myometrial-derived SMCs (mSMCs) of uterus. Thus, overexpression of this protein results in the development of uterine fibroids.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71148

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Chunsik Lee et al.
Trends in molecular medicine, 19(8), 474-486 (2013-05-30)
The importance of neurovascular crosstalk in development, normal physiology, and pathologies is increasingly being recognized. Although vascular endothelial growth factor (VEGF), a prototypic regulator of neurovascular interaction, has been studied intensively, defining other important regulators in this process is warranted.
Di Wu et al.
PloS one, 7(9), e46477-e46477 (2012-10-03)
Cleft lip with or without palate (CL/P) is a common congenital anomaly with a high birth prevalence in China. Based on a previous linkage signal of nonsyndromic CL/P (NSCL/P) on the chromosomal region 4q31-q32 from the Chinese populations, we screened
Ove Bruland et al.
BMC cancer, 9, 425-425 (2009-12-09)
Members of the PDGF family have been suggested as potential biomarkers for papillary thyroid carcinomas (PTC). However, it is known that both expression and stimulatory effect of PDGF ligands can be affected by inflammatory cytokines. We have performed a microarray
Guangli Suo et al.
Biology of reproduction, 81(4), 749-758 (2009-06-26)
Leiomyomata uteri (i.e., uterine fibroids) are benign tumors arising from the abnormal growth of uterine smooth muscle cells (SMCs). We show here that the expression of platelet-derived growth factor C (PDGFC) is higher in approximately 80% of uterine fibroids than

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service