Skip to Content
MilliporeSigma
All Photos(3)

Key Documents

HPA006514

Sigma-Aldrich

Anti-JTB antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Jumping translocation breakpoint protein antibody produced in rabbit, Anti-PAR protein antibody produced in rabbit, Anti-Prostate androgen-regulated protein antibody produced in rabbit, Anti-Protein JTB precursor antibody produced in rabbit

Sign Into View Organizational & Contract Pricing
All Photos(3)

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA006514
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

EEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL

UniProt accession no.

O76095

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... JTB(10899)

General description

JTB (jumping translocation breakpoint) is a highly conserved transmembrane protein, and the gene to this protein is localized to human chromosome 1q21. This gene has four introns and five exons. It is composed of a signal sequence, and has a molecular weight of 13.2kDa. It is composed of 116 amino acids.

Immunogen

Protein JTB precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Jumping translocation (JT) results in the production of truncated JTB (jumping translocation breakpoint), which lacks the transmembrane domain. It is localized to epidermal differentiation complex (EDC) region of chromosome, and is involved in unbalanced translocations. This gene is expressed in multiple types of cancer tissues, and is up-regulated in hepatocellular carcinoma (HCC). Abnormal expression or structure of this gene results in cancerous transformation of tissues, due to apoptosis or abnormal cell growth. It acts as a tumor suppression in case of hepatitis B virus (HBV), and thus, might have potential as a therapeutic target in case of HCC related to HBV infection.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70708

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

S Hatakeyama et al.
Oncogene, 18(12), 2085-2090 (1999-05-13)
1q21 is frequently involved in different types of translocation in many types of cancers. Jumping translocation (JT) is an unbalanced translocation that comprises amplified chromosomal segments jumping to various telomeres. In this study, we identified a novel gene human JTB
Yun-Peng Liu et al.
PloS one, 7(5), e36914-e36914 (2012-05-23)
The expression of the jumping translocation breakpoint (JTB) gene is upregulated in malignant liver tissues; however, JTB is associated with unbalanced translocations in many other types of cancer that suppress JTB expression. No comprehensive analysis on its function in human

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service