Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

HPA026815

Sigma-Aldrich

Anti-BRCA2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-BRCC2, Anti-FACD, Anti-FAD, Anti-FAD1, Anti-FANCD, Anti-FANCD1, Anti-breast cancer 2, early onset

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$450.50

$450.50

List Price$530.00Save 15%

Estimated to ship onApril 28, 2025



Select a Size

Change View
100 μL
$450.50

About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

$450.50

List Price$530.00Save 15%

Estimated to ship onApril 28, 2025


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL

immunogen sequence

VHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLS

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BRCA2(675)

General description

Breast cancer susceptibility gene 2 (BRCA2) is mapped to human chromosome 13q12-q13. The protein encoded by this gene is characterized with BRC repeats in exon 11 and a highly conserved radiation sensitive protein 51 (RAD51) binding domain in exon 27.

Immunogen

breast cancer 2, early onset recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Aberration in the breast cancer susceptibility gene 2 (BRCA2) increases the risk for susceptibility of breast cancer and ovarian cancer. BRCA2 is a vital element of DNA response pathway. BRCA2, on interaction with RAD51 gene, plays a role in DNA damage repair and homologous recombination. Loss of this action leads to cancer development.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70828

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Identification of the breast cancer susceptibility gene BRCA2.
Wooster R
Nature, 378(6559), 789-792 (1995)
Metastatic model of HPV+ oropharyngeal squamous cell carcinoma demonstrates heterogeneity in tumor metastasis.
Vermeer DW
Oncotarget, 7(17), 24194-24207 (2016)
Daniel W Vermeer et al.
Oncotarget, 7(17), 24194-24207 (2016-03-26)
Human papillomavirus induced (HPV+) cancer incidence is rapidly rising, comprising 60-80% of oropharyngeal squamous cell carcinomas (OPSCCs); while rare, recurrent/metastatic disease accounts for nearly all related deaths. An in vivo pre-clinical model for these invasive cancers is necessary for testing
Masaki Suzuki et al.
Translational lung cancer research, 12(8), 1738-1751 (2023-09-11)
High-grade fetal adenocarcinoma of the lung (H-FLAC) is a rare variant of pulmonary adenocarcinoma. Our previous study showed a high frequency of KMT2C mutations in lung cancers with an H-FLAC component, showing that KMT2C dysfunction may be associated with the
Cancer susceptibility of mice with a homozygous deletion in the COOH-terminal domain of the Brca2 gene.
McAllister KA
Cancer Research, 62(4), 990-994 (2002)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service