Skip to Content
MilliporeSigma
All Photos(4)

Key Documents

WH0255488M2

Sigma-Aldrich

Monoclonal Anti-IBRDC2 antibody produced in mouse

clone 4F1, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-IBR domain containing 2, Anti-KIAA0161, Anti-MGC71786, Anti-bA528A10.3, Anti-p53RFP

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4F1, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

IBR domain containing 2 (IBRDC2) is also known as ring finger protein 144B (RNF144B). It is an E3 ubiquitin ligase which is expressed in the ovaries, testis and spleen. The 303 amino acid protein is localized to the mitochondria, Golgi apparatus, cell membrane and cytoplasm. The gene encoding it is located on human chromosome 6p22.3.

Immunogen

IBRDC2 (NP_877434, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQYMQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQF

Biochem/physiol Actions

IBR domain containing 2 (IBRDC2) modulates the expression of the pro-apoptotic protein, Bax. It has a regulatory role in epithelial homeostasis and is involved in the stimulation of p53-dependent apoptosis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk_germany

nwg

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

F Conforti et al.
Oncogene, 32(40), 4758-4765 (2012-11-07)
ΔNp63 is a transcription factor that is critical for the development of stratified epithelia and is overexpressed or amplified in >80% of squamous cell carcinomas (SCCs). We identified the RING finger E3 ubiquitin ligase PIR2/Rnf144b as a direct transcriptional target
Hans M Albertsen et al.
PloS one, 8(3), e58257-e58257 (2013-03-09)
Endometriosis is a common gynecological condition with complex etiology defined by the presence of endometrial glands and stroma outside the womb. Endometriosis is a common cause of both cyclic and chronic pelvic pain, reduced fertility, and reduced quality-of-life. Diagnosis and
Giovanni Benard et al.
The EMBO journal, 29(8), 1458-1471 (2010-03-20)
Bax, a pro-apoptotic protein from the Bcl-2 family, is central to apoptosis regulation. To suppress spontaneous apoptosis, Bax must be under stringent control that may include regulation of Bax conformation and expression levels. We report that IBRDC2, an IBR-type RING-finger
Jun Huang et al.
FEBS letters, 580(3), 940-947 (2006-01-24)
Recently, it has been shown that really interesting new gene (RING)-in between ring finger (IBR)-RING domain-containing proteins, such as Parkin and Parc, are E3 ubiquitin ligases and are involved in regulation of apoptosis. In this report, we show that p53-inducible
Shiuh-Rong Ho et al.
Proceedings of the National Academy of Sciences of the United States of America, 111(26), E2646-E2655 (2014-07-01)
Several ring between ring fingers (RBR) -domain proteins, such as Parkin and Parc, have been shown to be E3 ligases involved in important biological processes. Here, we identify a poorly characterized RBR protein, Ring Finger protein 144A (RNF144A), as the

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service