WH0079813M5

Monoclonal Anti-EHMT1 antibody produced in mouse

clone 3G1, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-EUHMTASE1, Anti-EuHMTase1, Anti-FLJ12879, Anti-FP13812, Anti-GLP, Anti-KIAA1876, Anti-bA188C12.1, Anti-euchromatic histone-lysine N-methyltransferase 1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3G1, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_024757
• UniProt accession no.: Q9H9B1
• shipped in: dry ice
• storage temp.: −20°C
• Gene Information: human ... EHMT1(79813)

Description

General description

Euchromatic histone lysine methyltransferase 1 (EHMT1) is also known as G9a-like protein (GLP). It possesses N-terminal domains that have six ankyrin repeats. The gene encoding EHMT1 is localized on human chromosome 9q34.3.

Immunogen

EHMT1 (NP_079033, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILNKPA

Biochem/physiol Actions

Euchromatic histone lysine methyltransferase 1 (EHMT1) mono- and di-methylates histone H3 at the lysine 9 residue. Defects in the gene have been associated with Kleefstra syndrome or 9q34 deletion syndrome. EHMT1 associates with the transcription factor E2F6 and is involved in transcriptional inactivation through chromatin remodeling.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)