WH0057154M1

Monoclonal Anti-SMURF1 antibody produced in mouse

clone 1D7, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-KIAA1625, Anti-SMAD specific E3 ubiquitin protein ligase 1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1D7, monoclonal
• form: buffered aqueous solution
• species reactivity: rat, mouse, human
• technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_020429
• UniProt accession no.: Q9HCE7
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SMURF1(57154)

Description

General description

SMAD specific E3 ubiquitin protein ligase 1 (SMURF1) is an E3 ubiquitin ligase and the gene encoding it is localized on human chromosome 7q22.1.

Immunogen

SMURF1 (NP_065162, 165 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIP

Application

Monoclonal Anti-SMURF1 antibody produced in mouse has been used in Western Blotting.

Biochem/physiol Actions

SMAD specific E3 ubiquitin protein ligase 1 (SMURF1) acts as a negative regulator of transforming growth factor β (TGFβ) pathway. It has a role in the nuclear export of mothers against decapentaplegic homolog 7 (SMAD7) and the degradation of SMAD4. During epithelial-mesenchymal transition, SMURF1 dissolves tight junctions in cells. This protein also has a role in cell migration and in the bone morphogenetic protein pathway. SMURF1 has been associated with hepatocellular carcinoma.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)