Skip to Content
MilliporeSigma
All Photos(3)

Key Documents

WH0051529M1

Sigma-Aldrich

Monoclonal Anti-ANAPC11 antibody produced in mouse

clone 1B4-1A4, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-APC11, Anti-APC11 anaphase promoting complex subunit 11 homolog (yeast), Anti-Apc11p, Anti-HSPC214, Anti-MGC882

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1B4-1A4, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ANAPC11(51529)

General description

ANAPC11 (Anaphase promoting complex subunit 11) is a E3 ubiquitin ligase consisting of a RING-H2-finger domain with one histidine and seven cysteine residues that coordinate two Zn(2+) ions. It is mapped on the human chromosome 17q25 and is expressed in the cytoplasm and nucleus with discrete accumulation in granular structures in all the cell lines (AML 12, HepG2, and C2C12) transfected.

Immunogen

ANAPC11 (AAH00607, 1 a.a. ~ 54 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE

Biochem/physiol Actions

ANAPC11 (Anaphase promoting complex subunit 11) plays a key role in cell division by accelerating ubiquitination of cell-cycle regulators such as cyclin B and securin. It acts as the catalytic subunit of anaphase-promoting complex (APC) and helps to translocate ubiquitin from a ubiquitin-conjugating enzyme (E2) to the substrate. It controls the cell cycle progression through G1 phase of the cell cycle during protein modification.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

wgk_germany

nwg

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Tong-Shin Chang et al.
Free radical biology & medicine, 37(4), 521-530 (2004-07-17)
The anaphase-promoting complex (APC) is a ubiquitin-protein ligase (E3) that targets cell cycle regulators such as cyclin B and securin for degradation. The APC11 subunit functions as the catalytic core of this complex and mediates the transfer of ubiquitin from
A H Chan et al.
Journal of cellular biochemistry, 83(2), 249-258 (2001-09-27)
Yeast Apc11p together with Rbx1 and Roc2/SAG define a new class of RING-H2 fingers in a superfamily of E3 ubiquitin ligases. The human homolog of Apc11p, ANAPC11 was identified during a large-scale partial sequencing of a human liver cancer cDNA
Y-J Shi et al.
Genetics and molecular research : GMR, 11(3), 2814-2822 (2012-09-26)
Anaphase-promoting complex/cyclosome (APC/C) is a key E3 ubiquitin ligase in cell division, which catalyses ubiquitination of cell-cycle regulators. Studying this complex could reveal important information regarding its application in cancer research and therapy. In this study, 4 synthesized small interfering

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service