WH0051463M1

Monoclonal Anti-GPR89 antibody produced in mouse

clone 4D8, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-AL844549.1, Anti-G protein-coupled receptor 89, Anti-SH120
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4D8, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2bκ
• GenBank accession no.: BC003187
• UniProt accession no.: P0CG08
• shipped in: dry ice
• storage temp.: −20°C
• Gene Information: human ... GPR89B(51463)

Description

General description

G protein-coupled receptor 89 (GPR89) is expressed in the Golgi apparatus. The gene encoding this multi-transmembrane protein is localized on human chromosome 1q21.2.

Immunogen

GPR89 (AAH03187, 175 a.a. ~ 284 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK

Biochem/physiol Actions

G protein-coupled receptor 89 (GPR89) possesses a voltage-dependent anion-channel activity. It modulates Golgi function and regulates acidification.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)