Skip to Content
MilliporeSigma
All Photos(3)

Key Documents

WH0029089M1

Sigma-Aldrich

Monoclonal Anti-UBE2T antibody produced in mouse

clone 1E12-4A3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-HSPC150, Anti-ubiquitin-conjugating enzyme E2T (putative)

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
$392.00

$392.00


Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

Notify Me

Get notified when this item is ready to ship via email.


Select a Size

Change View
100 μG
$392.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$392.00


Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

Notify Me

Get notified when this item is ready to ship via email.

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1E12-4A3, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2bκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... UBE2T(29089)

General description

Ubiquitin conjugating enzyme E2 T (UBE2T) is an ubiquitin-conjugating (E2) enzyme. UBE2T gene is located on human chromosome 1q32.1. The covalent conjugation of ubiquitin to proteins regulates diverse cellular pathways and proteins. Ubiquitin is transferred to a target protein through a concerted action of a ubiquitin-activating enzyme (E1), a ubiquitin-conjugating enzyme (E2), such as UBE2T, and a ubiquitin ligase (E3) (Machida et al., 2006 [PubMed 16916645]).[supplied by OMIM]

Immunogen

UBE2T (AAH04152, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV

Biochem/physiol Actions

Ubiquitin conjugating enzyme E2 T (UBE2T) is important in cell proliferation. It contributes to monoubiquitination of Fanconi anemia group D2 protein (FANCD2) and maintains chromosome stability. UBE2T regulates protein degradation via proteasome. It is used as a prognostic biomarker for gastric cancer. UBE2T is overexpressed in cancers such as bladder cancer, lung cancer and prostate cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

UBE2T knockdown inhibits gastric cancer progression
Luo C, et al.
Oncotarget, 8(20), 32639-32639 (2017)
Knockdown of UBE2T inhibits osteosarcoma cell proliferation, migration, and invasion by suppressing the PI3K/Akt signaling pathway
Wang Y, et al.
Oncology Research, 24(5) (2016)
Yuichi J Machida et al.
Molecular cell, 23(4), 589-596 (2006-08-19)
The Fanconi anemia pathway is required for the efficient repair of damaged DNA. A key step in this pathway is the monoubiquitination of the FANCD2 protein by the ubiquitin ligase (E3) composed of Fanconi anemia core complex proteins. Here, we

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service