Skip to Content
MilliporeSigma
All Photos(5)

Key Documents

WH0010841M1

Sigma-Aldrich

Monoclonal Anti-FTCD antibody produced in mouse

clone 3A4, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-LCHC1, Anti-formiminotransferase cyclodeaminase

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
$406.00

$406.00


Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)


Select a Size

Change View
100 μG
$406.00

About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

$406.00


Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3A4, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FTCD(10841)

Related Categories

General description

FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.(supplied by OMIM) Formimidoyltransferase cyclodeaminase (FTCD) gene is localized in human fetal and adult liver. The gene is located on human chromosome 21q22.3.

Immunogen

FTCD (NP_996848, 440 a.a. ~ 541 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

Application

Monoclonal Anti-FTCD antibody produced in mouse has been used in indirect immunofluorescence staining, immunohistochemistry and immunocytochemistry.

Biochem/physiol Actions

Formimidoyltransferase cyclodeaminase (FTCD) deficiency is associated with formiminoglutamic aciduria. FTCD is considered as a therapeutic target for hepatocellular carcinoma (HCC). Mutations in FTCD is linked to glutamate formiminotransferase deficiency.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Allelic spectrum of formiminotransferase-cyclodeaminase gene variants in individuals with formiminoglutamic aciduria
Majumdar R, et al.
Molecular Genetics & Genomic Medicine, 5(6), 795-799 (2017)
Alteration of poly (ADP-ribose) glycohydrolase nucleocytoplasmic shuttling characteristics upon cleavage by apoptotic proteases
Bonicalzi M, et al,
Biology of the Cell, 95(9), 635-644 (2003)
Differential intracellular trafficking of von Willebrand factor (vWF) and vWF propeptide in porcine endothelial cells lacking Weibel-Palade bodies and in human endothelial cells
Royo T and Mart
Atherosclerosis, 167(1), 55-63 (2003)
Using a yeast two-hybrid system to identify FTCD as a new regulator for HIF-1alpha in HepG2 cells
Yu Z, et al.
Cellular Signalling, 26(7), 1560-1566 (2014)
Cloning and characterization of human FTCD on 21q22. 3, a candidate gene for glutamate formiminotransferase deficiency
Solans A, et al.
Cytogenetic and genome research, 88(1-2), 43-49 (2000)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service