Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

WH0010615M1

Sigma-Aldrich

Monoclonal Anti-SPAG5 antibody produced in mouse

clone 5F9, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-DEEPEST, Anti-MAP126, Anti-hMAP126, Anti-sperm associated antigen 5

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

5F9, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG3κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SPAG5(10615)

General description

This gene encodes a protein associated with the mitotic spindle apparatus. The encoded protein may be involved in the functional and dynamic regulation of mitotic spindles. (provided by RefSeq)

Immunogen

SPAG5 (AAH00322, 1082 a.a. ~ 1191 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEF

Biochem/physiol Actions

SPAG5 (Sperm associated antigen 5) plays a vital role in the mitosis and cell cycle regulation by controlling the formation and organization of microtubule, checkpoint regulation during cell division. It acts as a regulator and binds to the spindle during separation of sister chromatids. It is also involved in DNA damage repair. It has been suggested that overexpression of SPAG5 may indicate a pathogenic role in testicular development of patients with Down′s syndrome and cryptorchidism.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

12 - Non Combustible Liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Hee Jin Chung et al.
The Journal of biological chemistry, 291(34), 17579-17592 (2016-06-22)
The error-free segregation of chromosomes, which requires the precisely timed search and capture of chromosomes by spindles during early mitotic and meiotic cell division, is responsible for genomic stability and is achieved by the spindle assembly checkpoint in the metaphase-anaphase
Michele Salemi et al.
Neurological sciences : official journal of the Italian Neurological Society and of the Italian Society of Clinical Neurophysiology, 34(4), 549-551 (2012-07-10)
Men with Down's syndrome (DS) have an increased risk of cryptorchidism, but the mechanisms causing its onset are not clear. Cryptorchidism causes a primary testiculopathy responsible for infertility. SPAG5 mRNA is predominantly expressed in testis in pachytene spermatocytes. This observation
Jakob T Zipprich et al.
RNA (New York, N.Y.), 15(5), 781-793 (2009-03-24)
Proteins of the GW182 family play an important role in the execution of microRNA repression in metazoa. They interact directly with Argonaute proteins, components of microRNPs, and also form part of P-bodies, structures implicated in translational repression and mRNA degradation.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service