Skip to Content
MilliporeSigma
All Photos(7)

Key Documents

WH0010061M1

Sigma-Aldrich

Monoclonal Anti-ABCF2 antibody produced in mouse

clone 1D11, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-ABC28, Anti-ATP-binding cassette, sub-family F (GCN20), member 2, Anti-DKFZp586K1823, Anti-EST133090, Anti-HUSSY18, Anti-MABC1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
$406.00

$406.00

Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)
Notify Me

Get notified when this item is ready to ship via email.

All Photos(7)

Select a Size

Change View
100 μG
$406.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$406.00

Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)
Notify Me

Get notified when this item is ready to ship via email.

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1D11, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

BC001661

UniProt accession no.

Q9UG63

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ABCF2(10061)

General description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This protein is a member of the GCN20 subfamily. Alternative splicing of this gene results in multiple transcript variants. (provided by RefSeq)

Immunogen

ABCF2 (AAH01661, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNS

Biochem/physiol Actions

ATP binding cassette subfamily F member 2 (ABCF2) has been shown to bind to a-actinin-4 (ACTN4). It suppresses the activity of a channel named volume-sensitive outwardly rectifying anion channel (VSOR), which takes part in the efflux of chloride ions in epithelial cells. It has been reported that ABCF2 may be a prognostic marker for ovarian clear cell ovarian adenocarcinoma.

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
06265-1D11

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

S Nishimura et al.
British journal of cancer, 99(10), 1651-1655 (2008-11-13)
Uterine cervical and endometrial cancers are common malignant solid neoplasms for which there are no useful prognostic markers. In this study, we evaluate the relationship between ATP-binding cassette superfamily F2 (ABCF2) expression and clinical factors including clinical stage, histologic type
Yuhko Ando-Akatsuka et al.
Journal of cellular physiology, 227(10), 3498-3510 (2012-01-19)
After osmotic swelling, cell volume is regulated by a process called regulatory volume decrease (RVD). Although actin cytoskeletons are known to play a regulatory role in RVD, it is not clear how actin-binding proteins are involved in the RVD process.

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service