WH0009748M1

Monoclonal Anti-SLK antibody produced in mouse

clone 3E9, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-KIAA0204, Anti-STE20-like kinase (yeast), Anti-STK2, Anti-bA16H23.1, Anti-se209
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3E9, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: NM_014720
• UniProt accession no.: Q9H2G2
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SLK(9748)

Description

General description

STE20 like kinase (SLK) is a 1204 amino acid serine/threonine kinase. It possesses a kinase domain located at the amino-terminal and a C-terminal regulatory domain with coiled-coils. SLK is group V germinal center kinase that is expressed in the nucleus, cytosol, microtubules and centrosomes. The SLK gene is localized on human chromosome 10q24.33.

Immunogen

SLK (NP_055535, 1126 a.a. ~ 1235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KHENQMRDLQLQCEANVRELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLEEEFARKLQEQEVFFKMTGESECLNPSTQSRISKFYPIPSLHSTGS

Biochem/physiol Actions

STE20 like kinase (SLK) is a modulator of cell motility. It phosphorylates cytoskeleton-bound proteins, which take part in the remodeling of migratory cell architecture. SLK is also involved in mitogen-activated protein kinase pathways. It acts as an activator of Jun N-terminal kinase (JNK) and transactivates tumor suppressor p53.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class: 12 - Non Combustible Liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)