WH0007453M2

Monoclonal Anti-WARS antibody produced in mouse

clone 3A12, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-GAMMA2, Anti-IFI53, Anti-IFP53, Anti-tryptophanyl-tRNA synthetase
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3A12, monoclonal
• form: buffered aqueous solution
• species reactivity: mouse, rat, human
• technique(s): immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_004184
• UniProt accession no.: P23381
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... WARS(7453)

Description

General description

Tryptophanyl-tRNA synthetase, cytoplasmic (WARS) or IFP53 is the cytoplasmic form of tryptophanyl-tRNA synthetase. It is induced by interferons and the gene encoding it is localized on human chromosome 14q32.31.

Immunogen

WARS (NP_004175, 50 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDA

Biochem/physiol Actions

Tryptophanyl-tRNA synthetase, cytoplasmic (WARS) is involved in the tryptophan aminoacylation of tRNAtrp. Mutations in the gene encoding it have been associated with distal hereditary motor neuropathy.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)